CaMKI (CAMK1) (NM_003656) Human Mass Spec Standard

CAT#: PH318464

CAMK1 MS Standard C13 and N15-labeled recombinant protein (NP_003647)

Product Images

Coomassie blue staining of purified CAMK1 protein (Cat# TP318464). The protein was produced from HEK293T cells transfected with CAMK1 cDNA clone (Cat# RC218464) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218464
• Predicted MW: 41.2 kDa
• Protein Sequence:
  Sequence Link

  >RC218464 representing NM_003656
  Red=Cloning site Green=Tags(s)
  
  MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVL
  HKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHR
  DLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI
  LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDT
  ALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCC
  CRDCCVEPGTELSPTLPHQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003647
• RefSeq Size: 1501
• RefSeq ORF: 1110
• Synonyms: CAMKI
• Locus ID: 8536
• UniProt ID: Q14012, B0YIY3
• Cytogenetics: 3p25.3
• Summary: Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase