CHMP2A (NM_198426) Human Mass Spec Standard

CAT#: PH318563

CHMP2A MS Standard C13 and N15-labeled recombinant protein (NP_940818)

Product Images

Coomassie blue staining of purified CHMP2A protein (Cat# TP318563). The protein was produced from HEK293T cells transfected with CHMP2A cDNA clone (Cat# RC218563) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218563
• Predicted MW: 25.1 kDa
• Protein Sequence:
  Sequence Link

  >RC218563 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTR
  RYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKE
  EMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADA
  DLEERLKNLRRD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_940818
• RefSeq Size: 943
• RefSeq ORF: 666
• Synonyms: BC-2; BC2; CHMP2; VPS2; VPS2A
• Locus ID: 27243
• UniProt ID: O43633, A0A024R4S0
• Cytogenetics: 19q13.43
• Summary: CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]). [supplied by OMIM, Mar 2008]
• Protein Pathways: Endocytosis