RANKL (TNFSF11) (NM_003701) Human Mass Spec Standard
CAT#: PH318782
TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_003692)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218782 |
Predicted MW | 35.3 kDa |
Protein Sequence |
>RC218782 representing NM_003701
Red=Cloning site Green=Tags(s) MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYF RAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHI RAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQ DGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGF FKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003692 |
RefSeq Size | 2226 |
RefSeq ORF | 951 |
Synonyms | CD254; hRANKL2; ODF; OPGL; OPTB2; RANKL; sOdf; TNLG6B; TRANCE |
Locus ID | 8600 |
UniProt ID | O14788, Q5T9Y4 |
Cytogenetics | 13q14.11 |
Summary | This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401221 | TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403220 | TNFSF11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401221 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1 |
USD 396.00 |
|
LY403220 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2 |
USD 396.00 |
|
PH324778 | TNFSF11 MS Standard C13 and N15-labeled recombinant protein (NP_143026) |
USD 2,055.00 |
|
TP318782 | Purified recombinant protein of Homo sapiens tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1 |
USD 399.00 |
|
TP324778 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 2 |
USD 748.00 |
|
TP723421 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11), transcript variant 1. |
USD 240.00 |
|
TP723867 | Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 11 (TNFSF11 / RANKL), transcript variant 1 |
USD 270.00 |
{0} Product Review(s)
Be the first one to submit a review