EGFL7 (NM_016215) Human Mass Spec Standard

CAT#: PH318849

EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299)

Product Images

Coomassie blue staining of purified EGFL7 protein (Cat# TP318849). The protein was produced from HEK293T cells transfected with EGFL7 cDNA clone (Cat# RC218849) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218849
• Predicted MW: 29.4 kDa
• Protein Sequence:
  Sequence Link

  >RC218849 representing NM_016215
  Red=Cloning site Green=Tags(s)
  
  MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR
  TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE
  CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL
  EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057299
• RefSeq Size: 1569
• RefSeq ORF: 819
• Synonyms: NEU1; VE-STATIN; ZNEU1
• Locus ID: 51162
• UniProt ID: Q9UHF1, A0A024R8F5
• Cytogenetics: 9q34.3
• Summary: This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]
• Protein Families: Secreted Protein