RTL8B (NM_001078173) Human Mass Spec Standard

CAT#: PH318852

FAM127C MS Standard C13 and N15-labeled recombinant protein (NP_001071641)

Product Images

Coomassie blue staining of purified RTL8B protein (Cat# TP318852). The protein was produced from HEK293T cells transfected with RTL8B cDNA clone (Cat# RC218852) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218852
• Predicted MW: 13.2 kDa
• Protein Sequence:
  Sequence Link

  >RC218852 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLIT
  RLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001071641
• RefSeq Size: 2038
• RefSeq ORF: 339
• Synonyms: CXX1c; FAM127C; MAR8B; SIRH4
• Locus ID: 441518
• UniProt ID: Q17RB0
• Cytogenetics: Xq26.3
• Summary: Belongs to the FAM127 family. [UniProtKB/Swiss-Prot Function]