PPM1L (NM_139245) Human Mass Spec Standard

CAT#: PH318909

PPM1L MS Standard C13 and N15-labeled recombinant protein (NP_640338)

Product Images

Coomassie blue staining of purified PPM1L protein (Cat# TP318909). The protein was produced from HEK293T cells transfected with PPM1L cDNA clone (Cat# RC218909) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218909
• Predicted MW: 40.9 kDa
• Protein Sequence:
  Sequence Link

  >RC218909 representing NM_139245
  Red=Cloning site Green=Tags(s)
  
  MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND
  RLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK
  SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV
  GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP
  DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK
  FRNSSKTEEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_640338
• RefSeq Size: 3056
• RefSeq ORF: 1080
• Synonyms: PP2C-epsilon; PP2CE; PPM1-LIKE
• Locus ID: 151742
• UniProt ID: Q5SGD2
• Cytogenetics: 3q25.33-q26.1
• Summary: The protein encoded by this gene is a magnesium or manganese-requiring phosphatase that is involved in several signaling pathways. The encoded protein downregulates apoptosis signal-regulating kinase 1, a protein that initiates a signaling cascade that leads to apoptosis when cells are subjected to cytotoxic stresses. This protein also is an endoplasmic reticulum transmembrane protein that helps regulate ceramide transport from the endoplasmic reticulum to the Golgi apparatus. Finally, this gene may be involved in adiposity since it is upregulated in adipose tissues. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome, Phosphatase