PPM1L (NM_139245) Human Mass Spec Standard
CAT#: PH318909
PPM1L MS Standard C13 and N15-labeled recombinant protein (NP_640338)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218909 |
Predicted MW | 40.9 kDa |
Protein Sequence |
>RC218909 representing NM_139245
Red=Cloning site Green=Tags(s) MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND RLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK FRNSSKTEEQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_640338 |
RefSeq Size | 3056 |
RefSeq ORF | 1080 |
Synonyms | PP2C-epsilon; PP2CE; PPM1-LIKE |
Locus ID | 151742 |
UniProt ID | Q5SGD2 |
Cytogenetics | 3q25.33-q26.1 |
Summary | The protein encoded by this gene is a magnesium or manganese-requiring phosphatase that is involved in several signaling pathways. The encoded protein downregulates apoptosis signal-regulating kinase 1, a protein that initiates a signaling cascade that leads to apoptosis when cells are subjected to cytotoxic stresses. This protein also is an endoplasmic reticulum transmembrane protein that helps regulate ceramide transport from the endoplasmic reticulum to the Golgi apparatus. Finally, this gene may be involved in adiposity since it is upregulated in adipose tissues. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408320 | PPM1L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408320 | Transient overexpression lysate of protein phosphatase 1 (formerly 2C)-like (PPM1L) |
USD 325.00 |
|
TP318909 | Recombinant protein of human protein phosphatase 1 (formerly 2C)-like (PPM1L) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review