Glucokinase (GCK) (NM_033508) Human Mass Spec Standard
CAT#: PH318920
GCK MS Standard C13 and N15-labeled recombinant protein (NP_277043)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218920 |
Predicted MW | 51.9 kDa |
Protein Sequence |
>RC218920 representing NM_033508
Red=Cloning site Green=Tags(s) MPRPRSQLPQPNSQVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTYVRSTPEGSEV GDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKH KKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMI SCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESS ANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNI LSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKE RFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_277043 |
RefSeq Size | 2566 |
RefSeq ORF | 1392 |
Synonyms | FGQTL3; GK; GLK; HHF3; HK4; HKIV; HXKP; LGLK; MODY2 |
Locus ID | 2645 |
UniProt ID | P35557 |
Cytogenetics | 7p13 |
Summary | 'This gene encodes a member of the hexokinase family of proteins. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. The use of multiple promoters and alternative splicing of this gene result in distinct protein isoforms that exhibit tissue-specific expression in the pancreas and liver. In the pancreas, this enzyme plays a role in glucose-stimulated insulin secretion, while in the liver, this enzyme is important in glucose uptake and conversion to glycogen. Mutations in this gene that alter enzyme activity have been associated with multiple types of diabetes and hyperinsulinemic hypoglycemia. [provided by RefSeq, Aug 2017]' |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Insulin signaling pathway, Maturity onset diabetes of the young, Metabolic pathways, Starch and sucrose metabolism, Type II diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400059 | GCK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC403250 | GCK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC409539 | GCK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC429881 | GCK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400059 | Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 1 |
USD 325.00 |
|
LY403250 | Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 3 |
USD 495.00 |
|
LY409539 | Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 2 |
USD 495.00 |
|
LY429881 | Transient overexpression lysate of glucokinase (hexokinase 4) (GCK), transcript variant 2 |
USD 325.00 |
|
PH300472 | GCK MS Standard C13 and N15-labeled recombinant protein (NP_000153) |
USD 2,055.00 |
|
PH322793 | GCK MS Standard C13 and N15-labeled recombinant protein (NP_277042) |
USD 2,055.00 |
|
TP300472 | Recombinant protein of human glucokinase (hexokinase 4) (GCK), transcript variant 1 |
USD 867.00 |
|
TP318920 | Recombinant protein of human glucokinase (hexokinase 4) (GCK), transcript variant 3 |
USD 748.00 |
|
TP322793 | Recombinant protein of human glucokinase (hexokinase 4) (GCK), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review