Caspase 1 (CASP1) (NM_033294) Human Mass Spec Standard
CAT#: PH318982
CASP1 MS Standard C13 and N15-labeled recombinant protein (NP_150636)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218982 |
| Predicted MW | 29.6 kDa |
| Protein Sequence |
>RC218982 representing NM_033294
Red=Cloning site Green=Tags(s) MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTR LALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLV FMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDNVSWRHPTMGSVFIG RLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_150636 |
| RefSeq Size | 941 |
| RefSeq ORF | 789 |
| Synonyms | ICE; IL1BC; P45 |
| Locus ID | 834 |
| UniProt ID | P29466 |
| Cytogenetics | 11q22.3 |
| Summary | 'This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. [provided by RefSeq, Mar 2012]' |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Amyotrophic lateral sclerosis (ALS), Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409612 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC409613 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420065 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429054 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429865 | CASP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY409612 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant gamma |
USD 436.00 |
|
| LY409613 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta |
USD 436.00 |
|
| LY420065 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant beta |
USD 436.00 |
|
| LY429054 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant beta |
USD 396.00 |
|
| LY429865 | Transient overexpression lysate of caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta |
USD 396.00 |
|
| TP318982 | Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant delta |
USD 748.00 |
|
| TP760190 | Recombinant protein of human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
| TP761213 | Purified recombinant protein of -Human caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) (CASP1), transcript variant alpha, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China