TPM1 (NM_001018020) Human Mass Spec Standard
CAT#: PH318995
TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018020)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218995 |
| Predicted MW | 32.6 kDa |
| Protein Sequence |
>RC218995 representing NM_001018020
Red=Cloning site Green=Tags(s) MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRVSEDERDRVLEELHKAEDS LLAAEEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK MEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAA EDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLE LNNM myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001018020 |
| RefSeq Size | 1797 |
| RefSeq ORF | 852 |
| Synonyms | C15orf13; CMD1Y; CMH3; HEL-S-265; HTM-alpha; LVNC9; TMSA |
| Locus ID | 7168 |
| UniProt ID | P09493, O15513 |
| Cytogenetics | 15q22.2 |
| Summary | 'This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422687 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422688 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422689 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422690 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422696 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424765 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425413 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425414 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425415 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425416 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425418 | TPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY422687 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 3 |
USD 436.00 |
|
| LY422688 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 1 |
USD 436.00 |
|
| LY422689 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 4 |
USD 436.00 |
|
| LY422690 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 2 |
USD 436.00 |
|
| LY422696 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 7 |
USD 436.00 |
|
| LY424765 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 5 |
USD 436.00 |
|
| LY425413 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 3 |
USD 396.00 |
|
| LY425414 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 1 |
USD 396.00 |
|
| LY425415 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 4 |
USD 396.00 |
|
| LY425416 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 2 |
USD 396.00 |
|
| LY425418 | Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 7 |
USD 396.00 |
|
| PH301262 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_000357) |
USD 2,055.00 |
|
| PH318007 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018005) |
USD 2,055.00 |
|
| PH319543 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018004) |
USD 2,055.00 |
|
| PH319606 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018006) |
USD 2,055.00 |
|
| PH319652 | TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018007) |
USD 2,055.00 |
|
| TP301262 | Recombinant protein of human tropomyosin 1 (alpha) (TPM1), transcript variant 5 |
USD 823.00 |
|
| TP318007 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 1 |
USD 748.00 |
|
| TP318995 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 7 |
USD 748.00 |
|
| TP319543 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 3 |
USD 748.00 |
|
| TP319606 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 4 |
USD 748.00 |
|
| TP319652 | Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 2 |
USD 748.00 |
|
| TP720234 | Recombinant protein of human tropomyosin 1 (alpha) (TPM1), transcript variant 5 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China