DNMT3L (NM_175867) Human Mass Spec Standard
CAT#: PH319008
DNMT3L MS Standard C13 and N15-labeled recombinant protein (NP_787063)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219008 |
Predicted MW | 43.5 kDa |
Protein Sequence |
>RC219008 protein sequence
Red=Cloning site Green=Tags(s) MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIEDICICCGSLQVHTQHPLFEG GICAPCKDKFLDALFLYDDDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNW VCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLE SGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPGPF FWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_787063 |
RefSeq Size | 1720 |
RefSeq ORF | 1158 |
Synonyms | MGC1090 |
Locus ID | 29947 |
UniProt ID | Q9UJW3 |
Cytogenetics | 21q22.3 |
Summary | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases, but is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, it does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402250 | DNMT3L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406188 | DNMT3L HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402250 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1 |
USD 325.00 |
|
LY406188 | Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 2 |
USD 325.00 |
|
TP319008 | Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 2 |
USD 748.00 |
|
TP710295 | Purified recombinant protein of Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
|
TP761810 | Purified recombinant protein of Human DNA (cytosine-5-)-methyltransferase 3-like (DNMT3L), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review