LAMP1 (NM_005561) Human Mass Spec Standard

CAT#: PH319208

LAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_005552)

Product Images

Coomassie blue staining of purified LAMP1 protein (Cat# TP319208). The protein was produced from HEK293T cells transfected with LAMP1 cDNA clone (Cat# RC219208) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219208
• Predicted MW: 44.88 kDa
• Protein Sequence:
  Sequence Link

  >RC219208 representing NM_005561
  Red=Cloning site Green=Tags(s)
  
  MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSD
  ATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVE
  SITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSP
  SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS
  EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAF
  SVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005552
• RefSeq Size: 2560
• RefSeq ORF: 1251
• Synonyms: CD107a; LAMPA; LGP120
• Locus ID: 3916
• UniProt ID: P11279, A0A024RDY3
• Cytogenetics: 13q34
• Summary: 'The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008]'
• Protein Families: ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Lysosome