SP6 (NM_199262) Human Mass Spec Standard

CAT#: PH319213

SP6 MS Standard C13 and N15-labeled recombinant protein (NP_954871)

Product Images

Coomassie blue staining of purified SP6 protein (Cat# TP319213). The protein was produced from HEK293T cells transfected with SP6 cDNA clone (Cat# RC219213) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219213
• Predicted MW: 39.8 kDa
• Protein Sequence:
  Sequence Link

  >RC219213 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELP
  GASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALT
  SPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAA
  RPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSG
  DRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGE
  GKAGGAVEPPGGKGKREAEGSVAPSN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_954871
• RefSeq Size: 3794
• RefSeq ORF: 1128
• Synonyms: EPFN; EPIPROFIN; KLF14
• Locus ID: 80320
• UniProt ID: Q3SY56, B3KXP2
• Cytogenetics: 17q21.32
• Summary: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes (Scohy et al., 2000 [PubMed 11087666]). [supplied by OMIM, Mar 2008]
• Protein Families: Transcription Factors