PRPS2 (NM_001039091) Human Mass Spec Standard

CAT#: PH319227

PRPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001034180)

Product Images

Coomassie blue staining of purified PRPS2 protein (Cat# TP319227). The protein was produced from HEK293T cells transfected with PRPS2 cDNA clone (Cat# RC219227) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219227
• Predicted MW: 34.9 kDa
• Protein Sequence:
  Sequence Link

  >RC219227 representing NM_001039091
  Red=Cloning site Green=Tags(s)
  
  MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMEL
  LIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGF
  FDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVL
  VGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQ
  EDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001034180
• RefSeq Size: 2518
• RefSeq ORF: 963
• Synonyms: PRSII
• Locus ID: 5634
• UniProt ID: P11908, A0A140VK41
• Cytogenetics: Xp22.2
• Summary: 'This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pentose phosphate pathway, Purine metabolism