Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard

CAT#: PH319231

TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048)

Product Images

Coomassie blue staining of purified TRH protein (Cat# TP319231). The protein was produced from HEK293T cells transfected with TRH cDNA clone (Cat# RC219231) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219231
• Predicted MW: 27.4 kDa
• Protein Sequence:
  Sequence Link

  >RC219231 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS
  ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR
  SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL
  GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009048
• RefSeq Size: 1890
• RefSeq ORF: 726
• Synonyms: Pro-TRH; TRF
• Locus ID: 7200
• UniProt ID: P20396
• Cytogenetics: 3q22.1
• Summary: 'This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. [provided by RefSeq, May 2013]'
• Protein Families: Druggable Genome, Secreted Protein