FBXO44 (NM_183413) Human Mass Spec Standard

CAT#: PH319237

FBXO44 MS Standard C13 and N15-labeled recombinant protein (NP_904320)

Product Images

Coomassie blue staining of purified FBXO44 protein (Cat# TP319237). The protein was produced from HEK293T cells transfected with FBXO44 cDNA clone (Cat# RC219237) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219237
• Predicted MW: 25.7 kDa
• Protein Sequence:
  Sequence Link

  >RC219237 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI
  FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPV
  VRARASGDLPARPGDHPAEERCQVEGGLPHILQLPARRPLHLVSARRRGHSLLGRLVRPEGHQQQHHHRA
  PAALTPPEPPSAEP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_904320
• RefSeq Size: 2823
• RefSeq ORF: 672
• Synonyms: FBG3; FBX6A; FBX30; Fbx44; Fbxo6a
• Locus ID: 93611
• UniProt ID: Q9H4M3, A0A024R4J6
• Cytogenetics: 1p36.22
• Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Several alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Feb 2015]
• Protein Families: Druggable Genome