HCST (NM_001007469) Human Mass Spec Standard

CAT#: PH319253

HCST MS Standard C13 and N15-labeled recombinant protein (NP_001007470)

Product Images

Coomassie blue staining of purified HCST protein (Cat# TP319253). The protein was produced from HEK293T cells transfected with HCST cDNA clone (Cat# RC219253) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219253
• Predicted MW: 9.5 kDa
• Protein Sequence:
  Sequence Link

  >RC219253 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFL
  CARPRRSPAQEDGKVYINMPGRG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007470
• RefSeq Size: 521
• RefSeq ORF: 279
• Synonyms: DAP10; KAP10; PIK3AP
• Locus ID: 10870
• UniProt ID: Q9UBK5
• Cytogenetics: 19q13.12
• Summary: This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Natural killer cell mediated cytotoxicity