ENO3 (NM_001976) Human Mass Spec Standard

CAT#: PH319257

ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_001967)

Product Images

Coomassie blue staining of purified ENO3 protein (Cat# TP319257). The protein was produced from HEK293T cells transfected with ENO3 cDNA clone (Cat# RC219257) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219257
• Predicted MW: 46.8 kDa
• Protein Sequence:
  Sequence Link

  >RC219257 representing NM_001976
  Red=Cloning site Green=Tags(s)
  
  MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
  NTLGPALLQKKLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGN
  PDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDE
  GGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY
  KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSV
  TESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK
  AIFAGRKFRNPKAK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001967
• RefSeq Size: 1494
• RefSeq ORF: 1302
• Synonyms: GSD13; MSE
• Locus ID: 2027
• UniProt ID: P13929
• Cytogenetics: 17p13.2
• Summary: 'This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Jul 2010]'
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation