IL36 alpha (IL36A) (NM_014440) Human Mass Spec Standard

CAT#: PH319328

IL1F6 MS Standard C13 and N15-labeled recombinant protein (NP_055255)

Product Images

Coomassie blue staining of purified IL36A protein (Cat# TP319328). The protein was produced from HEK293T cells transfected with IL36A cDNA clone (Cat# RC219328) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219328
• Predicted MW: 17.7 kDa
• Protein Sequence:
  Sequence Link

  >RC219328 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKALKIDTPQRGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGL
  NLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLIL
  TQELGKANTTDFGLTMLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055255
• RefSeq Size: 477
• RefSeq ORF: 475
• Synonyms: FIL1; FIL1(EPSILON); FIL1E; IL-1F6; IL1(EPSILON); IL1F6
• Locus ID: 27179
• UniProt ID: Q9UHA7
• Cytogenetics: 2q14.1
• Summary: The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome, Secreted Protein