CD39 (ENTPD1) (NM_001776) Human Mass Spec Standard

CAT#: PH319359

ENTPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001767)

Product Images

Coomassie blue staining of purified ENTPD1 protein (Cat# TP319359). The protein was produced from HEK293T cells transfected with ENTPD1 cDNA clone (Cat# RC219359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219359
• Predicted MW: 58 kDa
• Protein Sequence:
  Sequence Link

  >RC219359 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE
  KENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRME
  SEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFG
  ALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD
  PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL
  PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL
  SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFT
  VAIIGLLIFHKPSYFWKDMV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001767
• RefSeq Size: 12493
• RefSeq ORF: 1533
• Synonyms: ATPDase; CD39; NTPDase-1; SPG64
• Locus ID: 953
• UniProt ID: P49961
• Cytogenetics: 10q24.1
• Summary: 'The protein encoded by this gene is a plasma membrane protein that hydrolyzes extracellular ATP and ADP to AMP. Inhibition of this protein's activity may confer anticancer benefits. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]'
• Protein Families: Transmembrane
• Protein Pathways: Purine metabolism, Pyrimidine metabolism