HVCN1 (NM_032369) Human Mass Spec Standard

CAT#: PH319422

HVCN1 MS Standard C13 and N15-labeled recombinant protein (NP_115745)

Product Images

Coomassie blue staining of purified HVCN1 protein (Cat# TP319422). The protein was produced from HEK293T cells transfected with HVCN1 cDNA clone (Cat# RC219422) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219422
• Predicted MW: 31.7 kDa
• Protein Sequence:
  Sequence Link

  >RC219422 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA
  APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH
  YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA
  RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115745
• RefSeq Size: 1727
• RefSeq ORF: 819
• Synonyms: HV1; VSOP
• Locus ID: 84329
• UniProt ID: Q96D96
• Cytogenetics: 12q24.11
• Summary: This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome, Transmembrane