GCOM1 (POLR2M) (NM_015532) Human Mass Spec Standard

CAT#: PH319621

GRINL1A MS Standard C13 and N15-labeled recombinant protein (NP_056347)

Product Images

Coomassie blue staining of purified POLR2M protein (Cat# TP319621). The protein was produced from HEK293T cells transfected with POLR2M cDNA clone (Cat# RC219621) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219621
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219621 representing NM_015532
  Red=Cloning site Green=Tags(s)
  
  MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR
  KSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD
  EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE
  ENASTKNLTGLSSGTEKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRR
  DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESS
  GRYREVRDEDDDWSSDEF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056347
• RefSeq Size: 4139
• RefSeq ORF: 1104
• Synonyms: GCOM1; Gdown; Gdown1; GRINL1A
• Locus ID: 81488
• UniProt ID: Q6EEV4, P0CAP2
• Cytogenetics: 15q21.3
• Summary: This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 4. Readthrough transcription between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein) is represented with GeneID 145781. [provided by RefSeq, Oct 2013]
• Protein Families: Druggable Genome, Ion Channels: Other