GnRH (GNRH1) (NM_001083111) Human Mass Spec Standard

CAT#: PH319734

GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580)

Product Images

Coomassie blue staining of purified GNRH1 protein (Cat# TP319734). The protein was produced from HEK293T cells transfected with GNRH1 cDNA clone (Cat# RC219734) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219734
• Predicted MW: 10.4 kDa
• Protein Sequence:
  Sequence Link

  >RC219734 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS
  PLRDLKGALESLIEEETGQKKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001076580
• RefSeq Size: 1297
• RefSeq ORF: 276
• Synonyms: GNRH; GRH; LHRH; LNRH
• Locus ID: 2796
• UniProt ID: P01148
• Cytogenetics: 8p21.2
• Summary: This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: GnRH signaling pathway