GPR73A (PROKR1) (NM_138964) Human Mass Spec Standard

CAT#: PH319745

PROKR1 MS Standard C13 and N15-labeled recombinant protein (NP_620414)

Product Images

Coomassie blue staining of purified PROKR1 protein (Cat# TP319745). The protein was produced from HEK293T cells transfected with PROKR1 cDNA clone (Cat# RC219745) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219745
• Predicted MW: 44.6 kDa
• Protein Sequence:
  Sequence Link

  >RC219745 representing NM_138964
  Red=Cloning site Green=Tags(s)
  
  METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV
  GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV
  NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK
  SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR
  KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV
  KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620414
• RefSeq Size: 1182
• RefSeq ORF: 1179
• Synonyms: GPR73; GPR73a; PK-R1; PKR1; ZAQ
• Locus ID: 10887
• UniProt ID: Q8TCW9
• Cytogenetics: 2p13.3
• Summary: This gene encodes a member of the G-protein-coupled receptor family. The encoded protein binds to prokineticins (1 and 2), leading to the activation of MAPK and STAT signaling pathways. Prokineticins are protein ligands involved in angiogenesis and inflammation. The encoded protein is expressed in peripheral tissues such as those comprising the circulatory system, lungs, reproductive system, endocrine system and the gastrointestinal system. The protein may be involved in signaling in human fetal ovary during initiation of primordial follicle formation. Sequence variants in this gene may be associated with recurrent miscarriage. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, GPCR, Transmembrane