FGFR4 (NM_022963) Human Mass Spec Standard
CAT#: PH319813
FGFR4 MS Standard C13 and N15-labeled recombinant protein (NP_075252)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219813 |
| Predicted MW | 80.9 kDa |
| Protein Sequence |
>RC219813 representing NM_022963
Red=Cloning site Green=Tags(s) MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEG SRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDLSNRH SYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLV MESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPH IQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTV LPGTGRIPHLTCDSLTPAGRTKSPTLQFSLESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLW EFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRH KNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQS DVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLV EALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_075252 |
| RefSeq Size | 2807 |
| RefSeq ORF | 2286 |
| Synonyms | CD334; JTK2; TKF |
| Locus ID | 2264 |
| UniProt ID | P22455 |
| Cytogenetics | 5q35.2 |
| Summary | 'The protein encoded by this gene is a tyrosine kinase and cell surface receptor for fibroblast growth factors. The encoded protein is involved in the regulation of several pathways, including cell proliferation, cell differentiation, cell migration, lipid metabolism, bile acid biosynthesis, vitamin D metabolism, glucose uptake, and phosphate homeostasis. This protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment, and a cytoplasmic tyrosine kinase domain. The extracellular portion interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. [provided by RefSeq, Aug 2017]' |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Endocytosis, MAPK signaling pathway, Regulation of actin cytoskeleton |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400735 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC403876 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC411457 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429711 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC431021 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400735 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 1 |
USD 436.00 |
|
| LY403876 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 3 |
USD 665.00 |
|
| LY411457 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 2 |
USD 665.00 |
|
| LY429711 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 2 |
USD 605.00 |
|
| LY431021 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 3 |
USD 605.00 |
|
| TP319813 | Recombinant protein of human fibroblast growth factor receptor 4 (FGFR4), transcript variant 2 |
USD 788.00 |
|
| TP700125 | Purified recombinant protein of human fibroblast growth factor receptor 4 (FGFR4), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China