CD30 (TNFRSF8) (NM_001243) Human Mass Spec Standard

CAT#: PH319819

TNFRSF8 MS Standard C13 and N15-labeled recombinant protein (NP_001234)

Product Images

Coomassie blue staining of purified TNFRSF8 protein (Cat# TP319819). The protein was produced from HEK293T cells transfected with TNFRSF8 cDNA clone (Cat# RC219819) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219819
• Predicted MW: 63.75 kDa
• Protein Sequence:
  Sequence Link

  >RC219819 representing NM_001243
  Red=Cloning site Green=Tags(s)
  
  MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCE
  PDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFP
  GTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTR
  APDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRT
  CECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSP
  TQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
  HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASP
  AGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHY
  PEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001234
• RefSeq Size: 3686
• RefSeq ORF: 1785
• Synonyms: CD30; D1S166E; Ki-1
• Locus ID: 943
• UniProt ID: P28908, A5D8T4
• Cytogenetics: 1p36.22
• Summary: 'The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction