PRB1 (NM_199354) Human Mass Spec Standard
CAT#: PH319911
PRB1 MS Standard C13 and N15-labeled recombinant protein (NP_955386)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219911 |
Predicted MW | 16 kDa |
Protein Sequence |
>RC219911 representing NM_199354
Red=Cloning site Green=Tags(s) MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQG PLPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNNPQ GPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_955386 |
RefSeq Size | 714 |
RefSeq ORF | 534 |
Synonyms | PM; PMF; PMS; PRB1L; PRB1M |
Locus ID | 5542 |
Cytogenetics | 12p13.2 |
Summary | 'This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature peptides before secretion from the parotid glands. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Medium" allele. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Nov 2015]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404537 | PRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404537 | Transient overexpression lysate of proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3 |
USD 325.00 |
|
TP319911 | Recombinant protein of human proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review