PRB1 (NM_199354) Human Mass Spec Standard

CAT#: PH319911

PRB1 MS Standard C13 and N15-labeled recombinant protein (NP_955386)

Product Images

Coomassie blue staining of purified PRB1 protein (Cat# TP319911). The protein was produced from HEK293T cells transfected with PRB1 cDNA clone (Cat# RC219911) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219911
• Predicted MW: 16 kDa
• Protein Sequence:
  Sequence Link

  >RC219911 representing NM_199354
  Red=Cloning site Green=Tags(s)
  
  MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQG
  PLPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNNPQ
  GPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_955386
• RefSeq Size: 714
• RefSeq ORF: 534
• Synonyms: PM; PMF; PMS; PRB1L; PRB1M
• Locus ID: 5542
• Cytogenetics: 12p13.2
• Summary: 'This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature peptides before secretion from the parotid glands. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Medium" allele. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Nov 2015]'
• Protein Families: Druggable Genome