TNFRSF18 (NM_004195) Human Mass Spec Standard

CAT#: PH319997

TNFRSF18 MS Standard C13 and N15-labeled recombinant protein (NP_004186)

Product Images

Coomassie blue staining of purified TNFRSF18 protein (Cat# TP319997). The protein was produced from HEK293T cells transfected with TNFRSF18 cDNA clone (Cat# RC219997) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219997
• Predicted MW: 26 kDa
• Protein Sequence:
  Sequence Link

  >RC219997 representing NM_004195
  Red=Cloning site Green=Tags(s)
  
  MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEW
  DCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFL
  TVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPP
  STEDARSCQFPEEERGERSAEEKGRLGDLWV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004186
• RefSeq Size: 1214
• RefSeq ORF: 723
• Synonyms: AITR; CD357; ENERGEN; GITR; GITR-D
• Locus ID: 8784
• UniProt ID: Q9Y5U5
• Cytogenetics: 1p36.33
• Summary: This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction