VPS24 (CHMP3) (NM_016079) Human Mass Spec Standard

CAT#: PH320006

VPS24 MS Standard C13 and N15-labeled recombinant protein (NP_057163)

Product Images

Coomassie blue staining of purified CHMP3 protein (Cat# TP320006). The protein was produced from HEK293T cells transfected with CHMP3 cDNA clone (Cat# RC220006) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220006
• Predicted MW: 25.1 kDa
• Protein Sequence:
  Sequence Link

  >RC220006 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS
  RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII
  EEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEAL
  EAMQSRLATLRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057163
• RefSeq Size: 3194
• RefSeq ORF: 666
• Synonyms: CGI-149; NEDF; VPS24
• Locus ID: 51652
• UniProt ID: Q9Y3E7
• Cytogenetics: 2p11.2
• Summary: This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010]
• Protein Pathways: Endocytosis