67kDa Laminin Receptor (RPSA) (NM_001012321) Human Mass Spec Standard
CAT#: PH320075
RPSA MS Standard C13 and N15-labeled recombinant protein (NP_001012321)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220075 |
Predicted MW | 32.8 kDa |
Protein Sequence |
>RC220075 protein sequence
Red=Cloning site Green=Tags(s) MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIEN PADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYV NLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEI EKEGQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP TAQATEWVGATTDWS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001012321 |
RefSeq Size | 1109 |
RefSeq ORF | 885 |
Synonyms | 37LRP; 67LR; ICAS; LAMBR; lamR; LAMR1; LBP; LBP/p40; LRP; LRP/LR; NEM/1CHD4; p40; SA |
Locus ID | 3921 |
Cytogenetics | 3p22.1 |
Summary | 'Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Ribosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400830 | RPSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC423324 | RPSA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400830 | Transient overexpression lysate of ribosomal protein SA (RPSA), transcript variant 1 |
USD 325.00 |
|
LY423324 | Transient overexpression lysate of ribosomal protein SA (RPSA), transcript variant 2 |
USD 325.00 |
|
PH309795 | RPSA MS Standard C13 and N15-labeled recombinant protein (NP_002286) |
USD 2,055.00 |
|
TP309795 | Purified recombinant protein of Homo sapiens ribosomal protein SA (RPSA), transcript variant 1 |
USD 823.00 |
|
TP320075 | Recombinant protein of human ribosomal protein SA (RPSA), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review