PBR (TSPO) (NM_000714) Human Mass Spec Standard

CAT#: PH320107

TSPO MS Standard C13 and N15-labeled recombinant protein (NP_000705)

Product Images

Coomassie blue staining of purified TSPO protein (Cat# TP320107). The protein was produced from HEK293T cells transfected with TSPO cDNA clone (Cat# RC220107) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220107
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC220107 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE
  LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY
  LAWLAFATTLNYCVWRDNHGWHGGRRLPE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000705
• RefSeq Size: 921
• RefSeq ORF: 507
• Synonyms: BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS; pk18; PKBS; PTBR
• Locus ID: 706
• UniProt ID: P30536, O76068
• Cytogenetics: 22q13.2
• Summary: 'Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. [provided by RefSeq, Feb 2012]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction