ZNF706 (NM_001042511) Human Mass Spec Standard
CAT#: PH320360
ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035976)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220360 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC220360 protein sequence
Red=Cloning site Green=Tags(s) MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE LADVQA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001035976 |
RefSeq Size | 2755 |
RefSeq ORF | 228 |
Synonyms | HSPC038; PNAS-106; PNAS-113 |
Locus ID | 51123 |
Cytogenetics | 8q22.3 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414186 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420950 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420951 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425760 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425761 | ZNF706 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414186 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 2 |
USD 396.00 |
|
LY420950 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 1 |
USD 396.00 |
|
LY420951 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 3 |
USD 396.00 |
|
LY425760 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 1 |
USD 396.00 |
|
LY425761 | Transient overexpression lysate of zinc finger protein 706 (ZNF706), transcript variant 3 |
USD 396.00 |
|
PH309807 | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_057180) |
USD 2,055.00 |
|
PH316962 | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) |
USD 2,055.00 |
|
TP309807 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 2 |
USD 823.00 |
|
TP316962 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 1 |
USD 748.00 |
|
TP320360 | Recombinant protein of human zinc finger protein 706 (ZNF706), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review