Integrin beta 4 binding protein (EIF6) (NM_181468) Human Mass Spec Standard

CAT#: PH320391

EIF6 MS Standard C13 and N15-labeled recombinant protein (NP_852133)

Product Images

Coomassie blue staining of purified EIF6 protein (Cat# TP320391). The protein was produced from HEK293T cells transfected with EIF6 cDNA clone (Cat# RC220391) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220391
• Predicted MW: 26.4 kDa
• Protein Sequence:
  Sequence Link

  >RC220391 representing NM_181468
  Red=Cloning site Green=Tags(s)
  
  MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGL
  LVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ
  TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT
  TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
  
  TRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_852133
• RefSeq Size: 1259
• RefSeq ORF: 735
• Synonyms: b(2)gcn; CAB; eIF-6; EIF3A; ITGB4BP; p27(BBP); p27BBP
• Locus ID: 3692
• UniProt ID: P56537
• Cytogenetics: 20q11.22
• Summary: 'Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]'
• Protein Families: Druggable Genome