Integrin Linked Kinase (ILK) (NM_001014794) Human Mass Spec Standard

CAT#: PH320460

ILK MS Standard C13 and N15-labeled recombinant protein (NP_001014794)

Product Images

Coomassie blue staining of purified ILK protein (Cat# TP320460). The protein was produced from HEK293T cells transfected with ILK cDNA clone (Cat# RC220460) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220460
• Predicted MW: 51.4 kDa
• Protein Sequence:
  Sequence Link

  >RC220460 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP
  LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA
  KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG
  RWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNV
  LHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRM
  YAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
  VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001014794
• RefSeq Size: 1797
• RefSeq ORF: 1356
• Synonyms: HEL-S-28; ILK-1; ILK-2; P59; p59ILK
• Locus ID: 3611
• UniProt ID: Q13418, V9HWF0
• Cytogenetics: 11p15.4
• Summary: 'This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]'
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Endometrial cancer, Focal adhesion, PPAR signaling pathway