Integrin Linked Kinase (ILK) (NM_001014794) Human Mass Spec Standard
CAT#: PH320460
ILK MS Standard C13 and N15-labeled recombinant protein (NP_001014794)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220460 |
Predicted MW | 51.4 kDa |
Protein Sequence |
>RC220460 protein sequence
Red=Cloning site Green=Tags(s) MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG RWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNV LHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRM YAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001014794 |
RefSeq Size | 1797 |
RefSeq ORF | 1356 |
Synonyms | HEL-S-28; ILK-1; ILK-2; P59; p59ILK |
Locus ID | 3611 |
UniProt ID | Q13418, V9HWF0 |
Cytogenetics | 11p15.4 |
Summary | 'This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]' |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Endometrial cancer, Focal adhesion, PPAR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401438 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC423078 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC423079 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC425365 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401438 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 1 |
USD 325.00 |
|
LY423078 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 2 |
USD 495.00 |
|
LY423079 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 3 |
USD 495.00 |
|
LY425365 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 3 |
USD 325.00 |
|
TP320460 | Recombinant protein of human integrin-linked kinase (ILK), transcript variant 2 |
USD 788.00 |
|
TP760620 | Purified recombinant protein of Human integrin-linked kinase (ILK), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review