PML Protein (PML) (NM_033246) Human Mass Spec Standard
CAT#: PH320522
PML MS Standard C13 and N15-labeled recombinant protein (NP_150249)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220522 |
Predicted MW | 47.4 kDa |
Protein Sequence |
>RC220522 representing NM_033246
Red=Cloning site Green=Tags(s) MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLRN ALW SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_150249 |
RefSeq Size | 1851 |
RefSeq ORF | 1269 |
Synonyms | MYL; PP8675; RNF71; TRIM19 |
Locus ID | 5371 |
UniProt ID | P29590 |
Cytogenetics | 15q24.1 |
Summary | 'The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Pathways in cancer, Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409649 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC409651 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC409652 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC409653 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC409655 | PML HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409649 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 9 |
USD 605.00 |
|
LY409651 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 5 |
USD 605.00 |
|
LY409652 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 7 |
USD 605.00 |
|
LY409653 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 8 |
USD 605.00 |
|
LY409655 | Transient overexpression lysate of promyelocytic leukemia (PML), transcript variant 11 |
USD 396.00 |
|
PH312067 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150242) |
USD 2,055.00 |
|
PH320236 | PML MS Standard C13 and N15-labeled recombinant protein (NP_150247) |
USD 2,055.00 |
|
TP312067 | Recombinant protein of human promyelocytic leukemia (PML), transcript variant 9 |
USD 867.00 |
|
TP320236 | Recombinant protein of human promyelocytic leukemia (PML), transcript variant 5 |
USD 748.00 |
|
TP320522 | Purified recombinant protein of Homo sapiens promyelocytic leukemia (PML), transcript variant 7 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review