Osteocalcin (BGLAP) (NM_199173) Human Mass Spec Standard
CAT#: PH320555
BGLAP MS Standard C13 and N15-labeled recombinant protein (NP_954642)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220555 |
Predicted MW | 8.7 kDa |
Protein Sequence |
>RC220555 representing NM_199173
Red=Cloning site Green=Tags(s) MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR REVCELNPDCDELADHIGFQEAYRRFYGPV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_954642 |
RefSeq Size | 498 |
RefSeq ORF | 300 |
Synonyms | BGP; OC; OCN |
Locus ID | 632 |
UniProt ID | P02818 |
Cytogenetics | 1q22 |
Summary | 'This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]' |
Protein Families | ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404673 | BGLAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404673 | Transient overexpression lysate of bone gamma-carboxyglutamate (gla) protein (BGLAP) |
USD 396.00 |
|
TP320555 | Recombinant protein of human bone gamma-carboxyglutamate (gla) protein (BGLAP) |
USD 748.00 |
|
TP701039 | Purified recombinant protein of Human bone gamma-carboxyglutamate (gla) protein (BGLAP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review