Osteocalcin (BGLAP) (NM_199173) Human Mass Spec Standard

CAT#: PH320555

BGLAP MS Standard C13 and N15-labeled recombinant protein (NP_954642)

Product Images

Coomassie blue staining of purified BGLAP protein (Cat# TP320555). The protein was produced from HEK293T cells transfected with BGLAP cDNA clone (Cat# RC220555) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220555
• Predicted MW: 8.7 kDa
• Protein Sequence:
  Sequence Link

  >RC220555 representing NM_199173
  Red=Cloning site Green=Tags(s)
  
  MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR
  REVCELNPDCDELADHIGFQEAYRRFYGPV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_954642
• RefSeq Size: 498
• RefSeq ORF: 300
• Synonyms: BGP; OC; OCN
• Locus ID: 632
• UniProt ID: P02818
• Cytogenetics: 1q22
• Summary: 'This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]'
• Protein Families: ES Cell Differentiation/IPS, Secreted Protein