AK3L1 (AK4) (NM_013410) Human Mass Spec Standard
CAT#: PH320572
AK3L1 MS Standard C13 and N15-labeled recombinant protein (NP_037542)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220572 |
Predicted MW | 25.1 kDa |
Protein Sequence |
>RC220572 representing NM_013410
Red=Cloning site Green=Tags(s) MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVIT RLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDF NPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLF SNKITPIQSKEAY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_037542 |
RefSeq Size | 2199 |
RefSeq ORF | 669 |
Synonyms | AK3; AK3L1; AK3L2; AK 4 |
Locus ID | 205 |
UniProt ID | P27144 |
Cytogenetics | 1p31.3 |
Summary | 'This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402259 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404279 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423694 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430929 | AK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402259 | Transient overexpression lysate of adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 6 |
USD 396.00 |
|
LY404279 | Transient overexpression lysate of adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 7 |
USD 396.00 |
|
LY423694 | Transient overexpression lysate of adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 5 |
USD 396.00 |
|
LY430929 | Transient overexpression lysate of adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 7 |
USD 396.00 |
|
PH324463 | AK3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001005353) |
USD 2,055.00 |
|
TP320572 | Recombinant protein of human adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 6 |
USD 748.00 |
|
TP324463 | Recombinant protein of human adenylate kinase 3-like 1 (AK3L1), nuclear gene encoding mitochondrial protein, transcript variant 5 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review