TNFAIP8 (NM_001077654) Human Mass Spec Standard

CAT#: PH320669

TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122)

Product Images

Coomassie blue staining of purified TNFAIP8 protein (Cat# TP320669). The protein was produced from HEK293T cells transfected with TNFAIP8 cDNA clone (Cat# RC220669) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220669
• Predicted MW: 21.7 kDa
• Protein Sequence:
  Sequence Link

  >RC220669 representing NM_001077654
  Red=Cloning site Green=Tags(s)
  
  MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVI
  KLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK
  SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001071122
• RefSeq Size: 1979
• RefSeq ORF: 564
• Synonyms: GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
• Locus ID: 25816
• UniProt ID: O95379
• Cytogenetics: 5q23.1
• Summary: Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome