SNRPB (NM_198216) Human Mass Spec Standard

CAT#: PH320701

SNRPB MS Standard C13 and N15-labeled recombinant protein (NP_937859)

Product Images

Coomassie blue staining of purified SNRPB protein (Cat# TP320701). The protein was produced from HEK293T cells transfected with SNRPB cDNA clone (Cat# RC220701) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220701
• Predicted MW: 24.4 kDa
• Protein Sequence:
  Sequence Link

  >RC220701 representing NM_198216
  Red=Cloning site Green=Tags(s)
  
  MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV
  LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ
  VMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRG
  TPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_937859
• RefSeq Size: 1007
• RefSeq ORF: 720
• Synonyms: CCMS; COD; Sm-B/B'; SmB/B'; SmB/SmB'; snRNP-B; SNRPB1
• Locus ID: 6628
• UniProt ID: P14678
• Cytogenetics: 20p13
• Summary: 'The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome, Systemic lupus erythematosus