RIPPLY2 (NM_001009994) Human Mass Spec Standard

CAT#: PH320725

RIPPLY2 MS Standard C13 and N15-labeled recombinant protein (NP_001009994)

Product Images

Coomassie blue staining of purified RIPPLY2 protein (Cat# TP320725). The protein was produced from HEK293T cells transfected with RIPPLY2 cDNA clone (Cat# RC220725) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220725
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC220725 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASG
  KLYQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDEIEDLTCEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001009994
• RefSeq Size: 674
• RefSeq ORF: 384
• Synonyms: C6orf159; dJ237I15.1; SCDO6
• Locus ID: 134701
• UniProt ID: Q5TAB7
• Cytogenetics: 6q14.2
• Summary: This gene encodes a nuclear protein that belongs to a novel family of proteins required for vertebrate somitogenesis. Members of this family have a tetrapeptide WRPW motif that is required for interaction with the transcriptional repressor Groucho and a carboxy-terminal Ripply homology domain/Bowline-DSCR-Ledgerline conserved region required for transcriptional repression. Null mutant mice die soon after birth and display defects in axial skeleton segmentation due to defective somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]