IL17E (IL25) (NM_172314) Human Mass Spec Standard

CAT#: PH320754

IL25 MS Standard C13 and N15-labeled recombinant protein (NP_758525)

Product Images

Coomassie blue staining of purified IL25 protein (Cat# TP320754). The protein was produced from HEK293T cells transfected with IL25 cDNA clone (Cat# RC220754) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220754
• Predicted MW: 16.7 kDa
• Protein Sequence:
  Sequence Link

  >RC220754 representing NM_172314
  Red=Cloning site Green=Tags(s)
  
  MYQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRA
  ISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYC
  LERRLYRVSLACVCVRPRVMG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_758525
• RefSeq Size: 1187
• RefSeq ORF: 483
• Synonyms: IL17E
• Locus ID: 64806
• UniProt ID: Q9H293
• Cytogenetics: 14q11.2
• Summary: The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction