GRB10 (NM_001001550) Human Mass Spec Standard
CAT#: PH320822
GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001550)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220822 |
Predicted MW | 60.8 kDa |
Protein Sequence |
>RC220822 protein sequence
Red=Cloning site Green=Tags(s) MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQ QFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLV YKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVT WCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLAD LEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYR IPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPL HPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCE DDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001001550 |
RefSeq Size | 4793 |
RefSeq ORF | 1608 |
Synonyms | Grb-10; GRB-IR; IRBP; MEG1; RSS |
Locus ID | 2887 |
UniProt ID | Q13322 |
Cytogenetics | 7p12.1 |
Summary | 'The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2010]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417385 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC424374 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC424375 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC424378 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417385 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 1 |
USD 605.00 |
|
LY424374 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 2 |
USD 605.00 |
|
LY424375 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 3 |
USD 605.00 |
|
LY424378 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 4 |
USD 396.00 |
|
PH306853 | GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001555) |
USD 2,055.00 |
|
TP306853 | Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 4 |
USD 867.00 |
|
TP320822 | Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review