UCK (UCK1) (NM_031432) Human Mass Spec Standard

CAT#: PH320876

UCK1 MS Standard C13 and N15-labeled recombinant protein (NP_113620)

Product Images

Coomassie blue staining of purified UCK1 protein (Cat# TP320876). The protein was produced from HEK293T cells transfected with UCK1 cDNA clone (Cat# RC220876) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220876
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC220876 representing NM_031432
  Red=Cloning site Green=Tags(s)
  
  MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV
  LTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGI
  LVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVII
  PRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRPH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_113620
• RefSeq Size: 2160
• RefSeq ORF: 831
• Synonyms: URK1
• Locus ID: 83549
• UniProt ID: Q9HA47
• Cytogenetics: 9q34.13
• Summary: This gene encodes a uridine-cytidine kinase that catalyzes the phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP) but not the phosphorylation of deoxyribonucleosides or purine ribonucleosides. This enzyme can also phosphorylate uridine and cytidine analogs and uses both ATP and GTP as a phosphate donor. Alternative splicing results in multiple splice variants encoding distinct isoforms. [provided by RefSeq, May 2012]
• Protein Families: Druggable Genome
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism