UCK (UCK1) (NM_031432) Human Mass Spec Standard
CAT#: PH320876
UCK1 MS Standard C13 and N15-labeled recombinant protein (NP_113620)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220876 |
| Predicted MW | 31.3 kDa |
| Protein Sequence |
>RC220876 representing NM_031432
Red=Cloning site Green=Tags(s) MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVVILSQDRFYKV LTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTHSRLPETTVVYPADVVLFEGI LVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVII PRGVDNMVAINLIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRPH myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_113620 |
| RefSeq Size | 2160 |
| RefSeq ORF | 831 |
| Synonyms | URK1 |
| Locus ID | 83549 |
| UniProt ID | Q9HA47 |
| Cytogenetics | 9q34.13 |
| Summary | This gene encodes a uridine-cytidine kinase that catalyzes the phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP) but not the phosphorylation of deoxyribonucleosides or purine ribonucleosides. This enzyme can also phosphorylate uridine and cytidine analogs and uses both ATP and GTP as a phosphate donor. Alternative splicing results in multiple splice variants encoding distinct isoforms. [provided by RefSeq, May 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403114 | UCK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427742 | UCK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403114 | Transient overexpression lysate of uridine-cytidine kinase 1 (UCK1), transcript variant 1 |
USD 436.00 |
|
| LY427742 | Transient overexpression lysate of uridine-cytidine kinase 1 (UCK1), transcript variant 2 |
USD 436.00 |
|
| TP320876 | Recombinant protein of human uridine-cytidine kinase 1 (UCK1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China