SEC23B (NM_032986) Human Mass Spec Standard
CAT#: PH320880
SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_116781)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220880 |
Predicted MW | 86.3 kDa |
Protein Sequence |
>RC220880 representing NM_032986
Red=Cloning site Green=Tags(s) MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQYEPVLCSRPTCKAVL NPLCQVDYRAKLWACNFCFQRNQFPPAYGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLYVVDTCLE EDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPA MPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGT FPNTGARIMLFTGGPPTQGPGMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIY ACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKDFNGDFRMAFGATLDVKTSRELKIAG AIGPCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNTPIPQGGRGAIQFVTHYQHS STQRRIRVTTIARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEEGPDVLRWLDRQLIRLCQKFG QYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPILYSYSF HGPPEPVLLDSSSILADRILLMDTFFQIVIYLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQA RFPMPRYINTEHGGSQARFLLSKVNPSQTHNNLYAWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_116781 |
RefSeq Size | 3126 |
RefSeq ORF | 2301 |
Synonyms | CDA-II; CDAII; CDAN2; CWS7; HEMPAS; hSec23B |
Locus ID | 10483 |
UniProt ID | Q15437 |
Cytogenetics | 20p11.23 |
Summary | The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants have been identified in this gene. [provided by RefSeq, Feb 2010] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403219 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409758 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416692 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429292 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC429831 | SEC23B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY403219 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 2 |
USD 396.00 |
|
LY409758 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 3 |
USD 396.00 |
|
LY416692 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1 |
USD 396.00 |
|
LY429292 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1 |
USD 605.00 |
|
LY429831 | Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 3 |
USD 605.00 |
|
PH310572 | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_116780) |
USD 2,055.00 |
|
PH317911 | SEC23B MS Standard C13 and N15-labeled recombinant protein (NP_006354) |
USD 2,055.00 |
|
TP310572 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 2 |
USD 867.00 |
|
TP317911 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1 |
USD 748.00 |
|
TP320880 | Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review