Esa1 (FLOT2) (NM_004475) Human Mass Spec Standard

CAT#: PH320884

FLOT2 MS Standard C13 and N15-labeled recombinant protein (NP_004466)

Product Images

Coomassie blue staining of purified FLOT2 protein (Cat# TP320884). The protein was produced from HEK293T cells transfected with FLOT2 cDNA clone (Cat# RC220884) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220884
• Predicted MW: 46.9 kDa
• Protein Sequence:
  Sequence Link

  >RC220884 representing NM_004475
  Red=Cloning site Green=Tags(s)
  
  MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT
  GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAP
  DVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADT
  KIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDK
  ELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQK
  YGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI
  KKATGVQV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004466
• RefSeq Size: 2659
• RefSeq ORF: 1284
• Synonyms: ECS-1; ECS1; ESA; ESA1; M17S1
• Locus ID: 2319
• UniProt ID: Q14254, A0A024QZ62, Q9BTI6
• Cytogenetics: 17q11.2
• Summary: 'Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Insulin signaling pathway