SRA1 (NM_001035235) Human Mass Spec Standard

CAT#: PH320899

SRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001030312)

Product Images

Coomassie blue staining of purified SRA1 protein (Cat# TP320899). The protein was produced from HEK293T cells transfected with SRA1 cDNA clone (Cat# RC220899) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220899
• Predicted MW: 25.5 kDa
• Protein Sequence:
  Sequence Link

  >RC220899 representing NM_001035235
  Red=Cloning site Green=Tags(s)
  
  MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSP
  GPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRR
  LALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFS
  EEAANEEKSAATAEKNHTIPGFQQAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001030312
• RefSeq Size: 1534
• RefSeq ORF: 1991
• Synonyms: pp7684; SRA; SRAP; STRAA1
• Locus ID: 10011
• UniProt ID: Q9HD15
• Cytogenetics: 5q31.3
• Summary: Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA. [provided by RefSeq, Mar 2012]