DKK3 (NM_015881) Human Mass Spec Standard
CAT#: PH321022
DKK3 MS Standard C13 and N15-labeled recombinant protein (NP_056965)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221022 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC221022 protein sequence
Red=Cloning site Green=Tags(s) MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVE EMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEE GRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDN QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSL VYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALGEPAAAAAALLGGEEI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056965 |
RefSeq Size | 2769 |
RefSeq ORF | 1050 |
Synonyms | REIC; RIG |
Locus ID | 27122 |
UniProt ID | Q9UBP4 |
Cytogenetics | 11p15.3 |
Summary | This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402468 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC415712 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422711 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425422 | DKK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402468 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 1 |
USD 396.00 |
|
LY415712 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 2 |
USD 396.00 |
|
LY422711 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 3 |
USD 396.00 |
|
LY425422 | Transient overexpression lysate of dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 3 |
USD 396.00 |
|
TP321022 | Recombinant protein of human dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 1 |
USD 748.00 |
|
TP720348 | Recombinant protein of human dickkopf homolog 3 (Xenopus laevis) (DKK3), transcript variant 3 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review