DLGAP4 (NM_001042486) Human Mass Spec Standard

CAT#: PH321038

DLGAP4 MS Standard C13 and N15-labeled recombinant protein (NP_001035951)

Product Images

Coomassie blue staining of purified DLGAP4 protein (Cat# TP321038). The protein was produced from HEK293T cells transfected with DLGAP4 cDNA clone (Cat# RC221038) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221038
• Predicted MW: 31.5 kDa
• Protein Sequence:
  Sequence Link

  >RC221038 representing NM_001042486
  Red=Cloning site Green=Tags(s)
  
  MSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPALEASSL
  PPPDPWLETSSSSPAEPAQPGACRRDGYWFLKLLQAETERLEGWCCQMDKETKENNLSEEVLGKVLSAVG
  SAQLLMSQKFQQFRGLCEQNLNPDANPRPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPE
  KRKEEKKPPPPVPKKPAKSKPAVSRDKASDASDKQRQEARKRLLAAKRAASVRQNSATESADSIEIYVPE
  AQTRL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035951
• RefSeq Size: 2982
• RefSeq ORF: 855
• Synonyms: DAP-4; DAP4; DLP4; SAPAP-4; SAPAP4
• Locus ID: 22839
• UniProt ID: Q9Y2H0, A0A0B4J2C2
• Cytogenetics: 20q11.23
• Summary: The product of this gene is a membrane-associated guanylate kinase found at the postsynaptic density in neuronal cells. It is a signaling molecule that can interact with potassium channels and receptors, as well as other signaling molecules. The protein encoded by this gene can interact with PSD-95 through its guanylate kinase domain and may be involved in clustering PSD-95 in the postsynaptic density region. The encoded protein is one of at least four similar proteins that have been found. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]