Germany
Japan
United Kingdom
China
OSBPL9 (NM_148908) Human Mass Spec Standard
CAT#: PH321053
OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683706)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221053 |
| Predicted MW | 81.6 kDa |
| Protein Sequence |
>RC221053 representing NM_148908
Red=Cloning site Green=Tags(s) MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGIDDEDDSTFTI TVDQKTFHFQARDADEREKWIHALEETILRHTLQLQGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLF DDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIAKSTINPVDAIYQPSPLEPVISTMPSQTVLP PEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSED EFYDADEFHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLNSSLSNGTSDADLFDSHDDRDDDA EAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDPKDRMVQV VKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVSEGPVPWVSKNSVTFVAEQVSHHP PISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTFPNGYGRSILTVPWVEL GGECNINCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCSIEGEWNGVMYAKYATGENTVFVD TKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKIRDIDAATEAKHRLEERQRAEARERKEKEIQWETRL FHEDGECWVYDEPLLKRLGAAKH myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_683706 |
| RefSeq Size | 2880 |
| RefSeq ORF | 2169 |
| Synonyms | ORP-9; ORP9 |
| Locus ID | 114883 |
| UniProt ID | Q96SU4 |
| Cytogenetics | 1p32.3 |
| Summary | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This family member functions as a cholesterol transfer protein that regulates Golgi structure and function. Multiple transcript variants, most of which encode distinct isoforms, have been identified. Related pseudogenes have been identified on chromosomes 3, 11 and 12. [provided by RefSeq, Jul 2010] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407760 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC407761 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LC407762 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LC407763 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LC407764 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LC407765 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LC430195 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC430196 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LC430197 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LC430198 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
| LY407760 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 1 |
USD 325.00 |
|
| LY407761 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 2 |
USD 495.00 |
|
| LY407762 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 3 |
USD 495.00 |
|
| LY407763 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 4 |
USD 495.00 |
|
| LY407764 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 5 |
USD 495.00 |
|
| LY407765 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 7 |
USD 495.00 |
|
| LY430195 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 3 |
USD 325.00 |
|
| LY430196 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 4 |
USD 325.00 |
|
| LY430197 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 5 |
USD 495.00 |
|
| LY430198 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 7 |
USD 495.00 |
|
| PH311520 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683707) |
USD 2,055.00 |
|
| PH321526 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683705) |
USD 2,055.00 |
|
| TP311520 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 7 |
USD 867.00 |
|
| TP321053 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 5 |
USD 748.00 |
|
| TP321526 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 4 |
USD 748.00 |
|
| TP760439 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
| TP760538 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review