Nogo A (RTN4) (NM_007008) Human Mass Spec Standard
CAT#: PH321080
RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_008939)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221080 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC221080 representing NM_007008
Red=Cloning site Green=Tags(s) MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQA IQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGA LFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_008939 |
| RefSeq Size | 1808 |
| RefSeq ORF | 597 |
| Synonyms | ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C |
| Locus ID | 57142 |
| UniProt ID | Q9NQC3 |
| Cytogenetics | 2p16.1 |
| Summary | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402073 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC403920 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC412411 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429630 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC430995 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402073 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 3 |
USD 436.00 |
|
| LY403920 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 4 |
USD 436.00 |
|
| LY412411 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 |
USD 665.00 |
|
| LY429630 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 |
USD 605.00 |
|
| LY430995 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 4 |
USD 396.00 |
|
| PH320981 | RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_997403) |
USD 2,055.00 |
|
| TP320981 | Recombinant protein of human reticulon 4 (RTN4), transcript variant 4 |
USD 788.00 |
|
| TP321080 | Recombinant protein of human reticulon 4 (RTN4), transcript variant 3 |
USD 748.00 |
|
| TP720993 | Purified recombinant protein of Human reticulon 4 (RTN4), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China