Uroguanylin (GUCA2B) (NM_007102) Human Mass Spec Standard
CAT#: PH321085
GUCA2B MS Standard C13 and N15-labeled recombinant protein (NP_009033)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221085 |
Predicted MW | 12.1 kDa |
Protein Sequence |
>RC221085 protein sequence
Red=Cloning site Green=Tags(s) MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHP ALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009033 |
RefSeq Size | 597 |
RefSeq ORF | 336 |
Synonyms | GCAP-II; UGN |
Locus ID | 2981 |
UniProt ID | Q16661 |
Cytogenetics | 1p34.2 |
Summary | 'This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416197 | GUCA2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416197 | Transient overexpression lysate of guanylate cyclase activator 2B (uroguanylin) (GUCA2B) |
USD 396.00 |
|
TP321085 | Recombinant protein of human guanylate cyclase activator 2B (uroguanylin) (GUCA2B) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review